PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA03G36750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 349aa    MW: 35668.2 Da    PI: 9.803
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA03G36750.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1214.3e-3866123360
           zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                      ++ l+cprC+s+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk + 
  ONIVA03G36750.1  66 QAPLRCPRCNSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKPRP 123
                      66789**************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.4E-3268122IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.09669123IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-2469118IPR003851Zinc finger, Dof-type
PROSITE patternPS01361071107IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MDQLKGASAL NHASQPVVLQ PIVSNPSPTS SSSTSSRSSA QATQQRSSSA TSSPHGQGQG  60
GGAAEQAPLR CPRCNSSNTK FCYYNNYNLT QPRHFCKTCR RYWTKGGALR NVPIGGGCRK  120
PRPMPAPVAK PPMSCKAAPP LGLGGGPVSW ASGQQAATAH LMALLNSARG VQGHGGSNVH  180
RLLGLDTMGH LQILPGAPNG AGAGTAASLW PQSAPRPVTP PPPHMDSQLG MGTLGHHDVL  240
SSLGLKLPSS ASSSPAASYY SDQLHAVVSN AGRPQAPYDV ATASLPCTTA VTSLPSALSS  300
VSAAAPTSNT VGMDLPPVSL AAPEMQYWNG PAAMSVPWPD LPTPNGAFP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629418.10.0PREDICTED: uncharacterized protein LOC4334219
TrEMBLA0A0E0GU730.0A0A0E0GU73_ORYNI; Uncharacterized protein
STRINGLOC_Os03g55610.10.0(Oryza sativa Japonica Group)
STRINGORGLA03G0322700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77103144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.12e-30Dof family protein